PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_76757.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YA
Protein Properties Length: 241aa    MW: 26550.6 Da    PI: 9.2122
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_76757.6genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.12.2e-3176132158
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
  MLOC_76757.6  76 DAPVYVNAKQYEGILRRRRARAKAEKENRL-VKARKPYLHESRHLHAMRRARGSGGRF 132
                   68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-3574135IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.73675135IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.8E-2878132IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-2378100IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS00686080100IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-23109132IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVHLGSGKGG NSSEHSAPIT LQSPFTEYND HFELGLGQSV ISSSYYSDQQ YGLLSSYAMR  60
SAYSGRMLIP LNMPADAPVY VNAKQYEGIL RRRRARAKAE KENRLVKARK PYLHESRHLH  120
AMRRARGSGG RFLNTKKETN GKDTGVGSTA MGGNQFMRPT ASLSSEIQHS EQGNPSSVSS  180
LSGSEVTSLY DHEDVDHYHN FEHLRTHFFT PLPSIMDGEH GAGNPFKWAA ASDGCCNLLK  240
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A2e-1876134261HAPB protein
4g91_A2e-1876134261HAPB protein
4awl_A3e-1876140266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3770240.0AK377024.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3145N16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757443.11e-121PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_010237001.11e-121PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_003577268.11e-121PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
TrEMBLM0Z4C60.0M0Z4C6_HORVD; Uncharacterized protein
STRINGMLOC_76757.21e-155(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.35e-28nuclear factor Y, subunit A10